PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 20203.3 Da    PI: 10.3749
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71714.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.2e-31958150
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                k+ienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  EPS71714.1  9 KKIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                68**********************************************95 PP

2K-box98.59.5e-3378169798
       K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 + ++e+++ s+qqe+akLk ++++Lqr qRhllGedL++Ls+keL++Le+qLe +l + R +K+++l+eq+e+l++ke+el + nk+L+ k+
  EPS71714.1  78 ETTSERETRSWQQEIAKLKTKYDSLQRAQRHLLGEDLGPLSVKELHNLEKQLEAALLQARHRKTQMLMEQMEHLRRKERELGDMNKNLKIKI 169
                 33689999********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.487161IPR002100Transcription factor, MADS-box
SMARTSM004329.8E-42160IPR002100Transcription factor, MADS-box
CDDcd002657.26E-43277No hitNo description
SuperFamilySSF554557.46E-34282IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-333859IPR002100Transcription factor, MADS-box
PfamPF014863.7E-2980169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.9685172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRGRVELKK IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGST  60
SAASTLERYR RCSYNHEETT SERETRSWQQ EIAKLKTKYD SLQRAQRHLL GEDLGPLSVK  120
ELHNLEKQLE AALLQARHRK TQMLMEQMEH LRRKERELGD MNKNLKIKIS LE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A1e-238717019102Developmental protein SEPALLATA 3
4ox0_B1e-238717019102Developmental protein SEPALLATA 3
4ox0_C1e-238717019102Developmental protein SEPALLATA 3
4ox0_D1e-238717019102Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843982.11e-101PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU393e-88MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLS8CWC21e-123S8CWC2_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000003832e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.13e-73AGAMOUS-like 6
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]